Verified Third-Party Tested·COA on Every Product·Free US Shipping over $599
≥99% PurityThird-Party TestedLot-Specific COAShips from the US
,

Tirzepatide · 5mg

$119.00

Dual GIP/GLP-1 receptor agonist research peptide.

SKU: AA-TIRZ-5MG Categories: ,

Specifications

Sequence
YAibEGTFTSDYSIYLDKIAQKAFVQWLIAGGPSSGAPPPS
Molecular Weight
4813.45
CAS Number
2023788-19-2

COA PDF for the current lot becomes available after add-to-cart, or via our COA Lookup tool.

For in-vitro research use only. Not for human consumption.

About this research peptide

Tirzepatide is a dual GIP/GLP-1 receptor agonist studied in literature relevant to glycemic regulation and body-composition research. Investigators working on PMOS metabolic models and the broader metabolic-endocrine spectrum have referenced Tirzepatide as a comparator in published preclinical studies.

Researchers exploring conditions that disproportionately affect women — including autoimmune-driven inflammation, perimenopausal symptom mapping, hormonal-metabolic dysregulation, and post-surgical recovery in women’s-health procedures — have included this compound in their reference libraries.

This product is supplied as a lyophilized powder of ≥99% purity, with a lot-specific Certificate of Analysis available through the link in the Specifications tab.

Cited research

Cited research will be published on this product page as new literature is indexed. Citations are provided for research context only — inclusion does not imply any health claim or endorsement of personal use.

Research-Use-Only Notice. This product is intended exclusively for in-vitro laboratory research by qualified researchers. It is not a drug, food, dietary supplement, cosmetic, or household product. It is not intended to diagnose, treat, cure, or prevent any disease or condition in humans or animals. By purchasing, the buyer affirms they are at least 21 years of age and accept full responsibility for compliant handling, storage, and disposal of the material in accordance with applicable laws.

Aphrodite Aminos curates every collection around the conditions that disproportionately affect women. Compounds in our Metabolic & Longevity research area are studied in published literature relevant to metabolic regulation, mitochondrial function, NAD+ pathways, and longevity biomarkers.

Only about 1% of biopharma R&D goes to female-specific conditions beyond oncology, and only ~2% of healthcare venture funding goes to women’s health. Every order supports the labs and independent researchers working to close that gap.

For in-vitro laboratory research only. Descriptions of research areas refer to published literature and do not imply any health claim or intended human use.

Researchers building reference compound libraries often pair this peptide with related materials from the same research area:

Suggestions are curated by research area and provided for context only; they do not imply any combined-use protocol.

Quality & testing

Each vial is tested by an independent ISO-accredited laboratory for identity (mass spectrometry), purity (HPLC), and concentration. The COA for this lot is available for download after add-to-cart, and via our public COA Lookup tool.

Shipping & handling

  • Domestic US shipping in 1–3 business days from our US fulfillment center
  • Cold-chain packaging with ice packs as appropriate to compound stability
  • Discreet, unbranded outer packaging
  • Signature on delivery available at checkout

General laboratory storage protocol:

  • Store lyophilized material at -20°C, protected from light.
  • Store reconstituted material at 2–8°C and use within the manufacturer-recommended window.
  • Cold-chain packaging is included at no charge for shipments where compound stability warrants it.
  • Discreet, unbranded outer packaging; signature on delivery available at checkout.

Handle, store, and dispose of all research materials in accordance with applicable laws and institutional safety protocols.

Scroll to Top